PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c10_12410V3.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 517aa    MW: 57536.9 Da    PI: 6.508
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c10_12410V3.2.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.84.5e-171360148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT+eEde+l + v+ +G+g+W+++ +  g+ R++k+c++rw +yl
  Pp3c10_12410V3.2.p 13 KGAWTAEEDEKLRKHVETYGTGHWRSVGKLAGLQRCGKSCRLRWTNYL 60
                        79********************************************97 PP

2Myb_DNA-binding551.9e-1767109246
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         g+++ eE+ l+v++++ +G++ W++Ia+ m+ gRt++++k++w++
  Pp3c10_12410V3.2.p  67 GSFSSEEENLIVKLHEAHGSR-WSLIAAQMP-GRTDNDIKNHWNT 109
                         789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.147860IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-221063IPR009057Homeodomain-like
SuperFamilySSF466891.87E-3011107IPR009057Homeodomain-like
SMARTSM007174.0E-141262IPR001005SANT/Myb domain
PfamPF002491.9E-151360IPR001005SANT/Myb domain
CDDcd001675.15E-121560No hitNo description
PROSITE profilePS5129426.54661115IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.5E-2564115IPR009057Homeodomain-like
SMARTSM007171.1E-1565113IPR001005SANT/Myb domain
PfamPF002491.2E-1567109IPR001005SANT/Myb domain
CDDcd001674.32E-1268111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 517 aa     Download sequence    Send to blast
MTRLSTPYED VRKGAWTAEE DEKLRKHVET YGTGHWRSVG KLAGLQRCGK SCRLRWTNYL  60
RPDIRHGSFS SEEENLIVKL HEAHGSRWSL IAAQMPGRTD NDIKNHWNTR LKKKLCDMGI  120
DPVTHKRIAD VLKELAGTMA HPTGQGNQVE EEAKRRFRRE FGSIHHSLAF KFMPYQSLND  180
LRRHNLHDTD ALPRSELPSG DESQKSSINS GSYNMDESSC STEVAPSPSP TSPLSSIDME  240
QSNQNSYYGA DAKHYQSNIL QCMTGTVVEG SADPTLYLSL PRMTETIMAH LTETGDSVPS  300
SFQLPMLSLQ STSSEQFVFP TTRYENASNG FHPSAPIYDT SESAEEQQSV DYTRWLASTS  360
AFPQDADILN SRVSTAVHLP LSHFNSEPHN CLGEDQATIS YLHGSDMSKL RRNATAGELD  420
VWINLGFNQQ RSIKENVSYS SLREQSSTSP NGITGSIADI TTQHTFSGCT GHFANSISPN  480
LNITGVHSPF ASTPAAMRLY ECPVPTPRMV LWNMQE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-28101154108B-MYB
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPP1S141_40V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56110.12e-56myb domain protein 103